Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Linepithema humile
GeneLH24347
Positionscf7180001005077:775463..780965[GBrowse]
Ant Genomes Portalhttp://hymenopteragenome.org/cgi-bin/gb2/gbrowse/lhum_10/?name=LH24347
sequence mRNA:
>LH24347-RA
ATGGGACAGTCGGACGATATCGAGGATTCGACGTACAGTCGACACCAGGATCTCTGCCAGAAGTTAAATATGGACGCGAC
CGCCGCGTCCGAGGCCTGGAAGTCCTACGAAACTATCCGTCAGAACTATACTCTCGAGGGTGATCAATTGCATTGGATAG
GATGTGCATTATACGTAGCTTGTAGAAAATCCTCTACACCTACAGTGGGAAGGACTGGTGGTAATGTGGAAGGCAACTGT
GTATCATTGACACGTCTCTTGCAATTGTGTAATCTTCCATTGATACAATTCTTTACAAAAAGCAAATCATGGGCAGATAT
GGCAAATATGCCGCAAGATTTTCGCACCAAGATAAAAAAGCTAGAAACAAAGTTTTCAGTTTCTTGGCTTATATTTACAA
AATATCAGCCACTGTTTACTGATATATTTAAGGATCCCAAAGAGGATACTACTAGACCGCCTAGGTCTAGAAGACACAAA
GCAGTTCCCTGTACCCCTTCCAGGGTCTTTGAATTCTGTTGGACATTATTTATATATATAAAGGGTACATTTCCTGATAT
TTCGGACGACCTTGTTAACTCTTATCATCTCTTGTTAGTCTGCTGTGATCTTATATATAACAATGCTGTGTTGGCAAACA
GAAAAGATTTGTTAAATCCCAATTTTTCTGGCTTACCAGCAAACTTCAATGATGAGAATTATAGTCCACCAAGAACAATT
GATTGCATTGTTAGTTTGTTGTGTGAACGTCATGGAGCAATCCCTATTGAGGCTAAAGTTATAAAGGAATATTACATGAA
AAATTGTATGAATAAACTATTTAATGAGAAGATCTTACGCGGTGATCAATCAAATTTCTCTGGTATACTAGGCACTGAGG
CACTGAGTTTCGATAGTAACAACAAAGCCATTAACAAGGCTTATGAACAGCGTGTATTAAGCGTTGGGGATTTTGATGAA
AGAATTTTTTTAGGCAACGACGCTAATGAAAATATCGGTTCTCCTACGCAAATGATGAACATTGATGATTTTCGTGAACA
ATTGCAAATGAAGAAAGAACAGCATATTGGGATGCAGTACATGGCACCTCCTACACCACTGACTGGTCGTAAATATCTCC
GATCGAAGGATATGTCTAATATAACGCCAGTTATTACGGCGACTCAAAGTGTCATTAAGTTACAAGCTTTGATAGCTGGG
CAATCTGCTCCAAGTGAAAGCCTCTTGCAAATGTTGAACAGTTGTTCTCAAAACGTTAAATCTTTAGTCGAGGCCAAAGT
TACACAAATTGGTGAACAATTTTGCGCAAGTTATAACAATAATGTAAATTCCGCCAGCATAAACGACGGTTCGACATCAG
ACTATGGAAGGAGGCGTCTTCTTATGGGGCAAACTTTGTTTTATAAGCTTCTGGAAATGATTTTAAATGATGAAAAGCGC
AAGAAGCCAAATTACGACATAACTAATTTACTTTCAAATGAACTTTTTATTCAATGTCTGTTCGCTTGCTGTCTCGAGAT
AGTTATATATTCTTATCAGAGCAATGATAAGACATTTCCATGGATACTAAAAGCTTTGAATTTAGACGCTTACTATTTCT
ATAAAGTTATAGAAATTATAGTAAGAACTGAGGATCAATTATCACGGGATGTTGTCAAGCATTTGAATCAGATCGAAGAG
AAAATTCTGGAATCTTTAGCTTGGCAAAGCGATAGTCCTTTATGGCAAACTATTGTTTCCTTAAAGGATGGTGTGCCGAG
TTGTGAGGAAGTATCTTTACCTGGCACATTGGAAACTGTTGATCCAAACGCACCTGGTCAACCGGTATTGAGACGGATGG
CTTTTGATCGTGATCGTACCCATCATGATGTTCAACAAAGTCCAATTTCGTCTGCTTCAGAAAGGTTTCAGTCTCCTATC
GCAGGATCTGGTGTAGCGAAGAAGCGATTATTCCCTGAAACAAGAATTACCGGTCAAAGTGTCCTACGCGTCGGGCAGAG
CGTGTTATCTTCTAACAGAGGAGGACTGTTAATAGACGGAAGCCAAAAGATTCTTTTGGTACCCGATCAAGCCATTTCGA
AAACATCGGGCGCACAAGTTTCACATAATTCAGTACAAGTTGTTCAAACGGCCAACAAAGACATGGCTAAACCAAGAAAA
ACAGGTTCTGTTGCATTGTTTTTCCGAAAGTTCTACAATCTCGCGTTCGTACGCATGCAAGACTTGTGCAATTCGTTAGA
AATATCAGATACCGATAAGAAGAAGATCTGGACAATTTTCGAATACTCCATCAAGGATCGTACCGAATTGATGAAAGATC
GGCATCTCGATCAGATCTTAATGTGTGCAATTTATGTAATATGTAAATTGGTGAAGATGGAGAAGAACTCGTTCACTGAG
ATTATGCGGTGTTATCGTCTGCAACCGCAGGCGGAATCGCATATATATAGATCGGTGCTTATAACAAAAATTCCCAATGA
TGGAAATCCGACGATGAGCAATAATGAAAAATCGGAGGACAACGGGACATTGGGAGAAAATACAGCTCCGCCGACGCCGA
CAAATATGGCCGGGACATCGCAGAACTTCGACGGAGAGGAACGCGGTGATCTAATCAAATTCTACAATACGGTATACGTA
CCGCAGGTGAAGGATTTTGCAAACAAATTTGGATTGGCTCGCGGTAGCGTCATGAATCTCTCACTGAGCCCTTTACCAAA
AGGAAAAGCACCTGCTAATTCCCCAGTGAGACGTGTTACCAGTAGTATTATGACACGTACTCTGGACCCAAAGGCTATTA
GTGCGTCACCGGCGCCGCAATTAAGTTATTGTTTTAGTCGTAGTCCTGCCAAGGATTTAGAAGCCATCAATAAGATGATG
ATATCTGTAGAAGCGAAAAAGGGTGTAGGAAAACGATTGCTTTCTGATGATACCGATGTAGAAATGGCAGAAGGTACATC
TCCTAAAAAGCCCACGACCCTTCCTCTCCACGTCGCGCGAAAAGTGGAAAATATCATGGGAGACCGACGAACGCAAAATC
AATAA
PEP:
>LH24347-PA
MGQSDDIEDSTYSRHQDLCQKLNMDATAASEAWKSYETIRQNYTLEGDQLHWIGCALYVACRKSSTPTVGRTGGNVEGNC
VSLTRLLQLCNLPLIQFFTKSKSWADMANMPQDFRTKIKKLETKFSVSWLIFTKYQPLFTDIFKDPKEDTTRPPRSRRHK
AVPCTPSRVFEFCWTLFIYIKGTFPDISDDLVNSYHLLLVCCDLIYNNAVLANRKDLLNPNFSGLPANFNDENYSPPRTI
DCIVSLLCERHGAIPIEAKVIKEYYMKNCMNKLFNEKILRGDQSNFSGILGTEALSFDSNNKAINKAYEQRVLSVGDFDE
RIFLGNDANENIGSPTQMMNIDDFREQLQMKKEQHIGMQYMAPPTPLTGRKYLRSKDMSNITPVITATQSVIKLQALIAG
QSAPSESLLQMLNSCSQNVKSLVEAKVTQIGEQFCASYNNNVNSASINDGSTSDYGRRRLLMGQTLFYKLLEMILNDEKR
KKPNYDITNLLSNELFIQCLFACCLEIVIYSYQSNDKTFPWILKALNLDAYYFYKVIEIIVRTEDQLSRDVVKHLNQIEE
KILESLAWQSDSPLWQTIVSLKDGVPSCEEVSLPGTLETVDPNAPGQPVLRRMAFDRDRTHHDVQQSPISSASERFQSPI
AGSGVAKKRLFPETRITGQSVLRVGQSVLSSNRGGLLIDGSQKILLVPDQAISKTSGAQVSHNSVQVVQTANKDMAKPRK
TGSVALFFRKFYNLAFVRMQDLCNSLEISDTDKKKIWTIFEYSIKDRTELMKDRHLDQILMCAIYVICKLVKMEKNSFTE
IMRCYRLQPQAESHIYRSVLITKIPNDGNPTMSNNEKSEDNGTLGENTAPPTPTNMAGTSQNFDGEERGDLIKFYNTVYV
PQVKDFANKFGLARGSVMNLSLSPLPKGKAPANSPVRRVTSSIMTRTLDPKAISASPAPQLSYCFSRSPAKDLEAINKMM
ISVEAKKGVGKRLLSDDTDVEMAEGTSPKKPTTLPLHVARKVENIMGDRRTQNQ
Swiss-ProtRetinoblastoma-like protein 1
KEGGko04350    TGF-beta signaling pathway
ko04110    Cell cycle
ko05203    Viral carcinogenesis
     K04681  RBL1; retinoblastoma-like protein 1     
SUPERFAMILYSSF47954  Cyclin-like superfamily     
Gene3DG3DSA:1.10.472.10     
PfamPF01858  RB_A; Retinoblastoma-associated protein A domain     
OrthologiGroup-00010    Retinoblastoma-like protein     

You might be interested in these researchers

You might be interested in these references