Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Danaus plexippus
GeneDPOGS209702
PositionDPSCF300309:114043..118556[GBrowse]
MonarchBasehttp://monarchbase.umassmed.edu/tools3/Get_gene.cgi?id=DPOGS209702
sequence mRNA:
>DPOGS209702-TA
ATGGAGGAAACAGTAACTAATGCGTCGGATGTTGATAATTTTAAGCTCAAAAGATGTACAGATTGGTTGCTTCAGCAGAA
TAATCCAGACAAGTTGACCCGACAGAATCAGAATGATATTCAGTTTATTATCGAAACGAATGCCCATAGAAAGAAATTTT
TCCTTTCCGCTGCAGAGGATGAGGCAACAGTTCCAACTGGGGTCGATGAAAACACAGTCGAACCGGCAACCGTGCCTTTG
GCCCGTTTACGTAAAGACAATATACGGATGGAGTGTGAATGGCAATCCTGCAGGAAGTTCTTCACTAACTATGAAGTGTT
TCAGAAGCATGTAACAAAACATGCCTCTGACTTACATGTTATTGATATGGAAGGTGATGTGGACTATGTATGTCTGTGGG
ATATTTGCGGTCATCGCACCAAGGACTTTGTTGAGATGGTGCGTCATATTAGCTATCACGCTTATCACGCAAGACTTCTA
GCCATCGGTTACAATGCTCGAGCTACACTTAAACTGGACCAGTGTAAGAAGGACTCCAGCCGCCGTAATAGACTACCCTC
GCTGAAGTCCGATCATTGTTGTATGTGGATTGGATGTTCGGAAACTTTTTTTTCTATACAGACGTTTCTAGACCACATGA
AGCATCATATTTTCTACTCCGACGACTATCTCTGCTCGTGGGCCGGTTGTGGAGCGACCTTCACTAAACGACATTCCCTC
GTACTGCATCTGAGATCACATACACAAGAGAAAACCATAGCCTGCTTCCATTGCGGCAGACATTTCACATGTAACAGGAA
ACTTAGCGATCATTTAGCGAGGCAGAACGTAGACCCGTCGACGGGCTACCCGTGTAACATGTGCGGCACCGTACTGGCGA
GCGCGTACCTCCAGCGCGAGCACGCCCGCCAGCACGTGTCGGCGTACGCGTGCACTCTGTGCGACATGTCGGCGACCACC
CCCGCCGCTCTCGCCCACCACGTGCGGTACCGACACCTCGCCGACCACGCCAGGAGCTTCGCCTGCCCGCATTGTGTATA
CAGAGCGGTGACTAAATGTGATCTGCGCAAGCACATACTGACACATACAAGAAAAGCAAAGAAAAAGACTAAAGACGATA
GCGAGGATTCCGATGTTTCTGATGCAGAAGTCAAAAAGAAAAAGGAGCCAAAGAAATACGTGTGTCACTTGTGTCAGAAA
GACAGCAAGATATTCTCGCGCGGGACACGACTCACCACACACTTAGTAAAGGTACACGGAGCACAATGGCCGTTTGGACA
CAGTAGGTTTAGGTATCAAATCAGCGAGGACGGCATGTACAGGCTGACTACAACGAGATTTGAAGTTCTAGAAGTCTCCA
AGAAGATTGTTGACGGCTACAGCGGTCCGAAGGAATCACTGACTAATACATTCGAATTCGATCTGAAGCAGACGGCGGAC
GCCACGGAGACCACGCCCAAGAGGTTCGAAATAACCTTGAAGAATACCAACAAGAGTGACGAGGGAGGCTGCAAGCAGGC
CGGGGCTGTGGAGATAATGATGTGCGATGTAGACCAACAAGGAAACATTATAAGCACCGAGACCATTAAGTCTGACGTTG
TTTATACCTAA
PEP:
>DPOGS209702-PA
MEETVTNASDVDNFKLKRCTDWLLQQNNPDKLTRQNQNDIQFIIETNAHRKKFFLSAAEDEATVPTGVDENTVEPATVPL
ARLRKDNIRMECEWQSCRKFFTNYEVFQKHVTKHASDLHVIDMEGDVDYVCLWDICGHRTKDFVEMVRHISYHAYHARLL
AIGYNARATLKLDQCKKDSSRRNRLPSLKSDHCCMWIGCSETFFSIQTFLDHMKHHIFYSDDYLCSWAGCGATFTKRHSL
VLHLRSHTQEKTIACFHCGRHFTCNRKLSDHLARQNVDPSTGYPCNMCGTVLASAYLQREHARQHVSAYACTLCDMSATT
PAALAHHVRYRHLADHARSFACPHCVYRAVTKCDLRKHILTHTRKAKKKTKDDSEDSDVSDAEVKKKKEPKKYVCHLCQK
DSKIFSRGTRLTTHLVKVHGAQWPFGHSRFRYQISEDGMYRLTTTRFEVLEVSKKIVDGYSGPKESLTNTFEFDLKQTAD
ATETTPKRFEITLKNTNKSDEGGCKQAGAVEIMMCDVDQQGNIISTETIKSDVVYT
Swiss-ProtHistone H4 transcription factor
SUPERFAMILYSSF57667  beta-beta-alpha zinc fingers superfamily     
Gene3DG3DSA:3.30.160.60     
PfamPF13894  zf-C2H2_4; C2H2-type zinc finger     
SMARTSM00355     
ProSiteProfilesPS50157  ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile.     
ProSitePatternsPS00028  ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature.     
OrthologiGroup-00005    Histone H4 transcription factor      

You might be interested in these researchers

You might be interested in these references