Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Nasonia vitripennis
GeneNV15596
PositionSCAFFOLD28:912300..918271[GBrowse]
NasoniaBasehttp://hymenopteragenome.org/cgi-bin/gb2/gbrowse/nasonia10_scaffold/?name=NV15596
sequence mRNA:
>NV15596-RA
ATGGGGCAGTCCGACGACATCGAGGACGCGACGTTCATGAAGCACCAGGATCTCTGCCAAAAGCTCAACATGGACGCGAG
CGCGGCCAGCGAGGCCTGGAAATCTTACGAGAACATCAGGCAGCACTACACGCTCGAGGGCGACCAGCTGCATTGGATTG
GGTGTGCTCTGTACGCTGCATGTCGCAAAGCTACCACCCCCACTGTAGGCAAAACCGGAGCAAACATACAGGGCAACTGC
GTCTCCTTTACGAGGCTTCTCAGACTCTGCAACTTGCCTCTCATAGAGTTTTTCACCAAGAGTAAAGCATGGGCGGATAT
GTGCAACATGCCCCAGGATTTTGGCGCCAGGATTGACACGCTGCAAAGAAACTTTTCTGTTTCATCGGTCATATTTCAGA
AGTATCAGCCCATTTTCAAAGACATTTTTAAGAATCCTGCTGACGACTTGGGCAAACCACTAAGATCACGAAGACACAAA
GCTGTACCCTGTACACCTTCTAGATTGTTCGAGTTCTGCTGGTCACTTTTCATCTGCATCAAGAGCAAGATATCGGCTAT
TTCAGATGACCTCGTGAATTCTTATCACTTGTTGTTAGTATGCTGCGACTTAATGTACAGCAATGCTCTGTTAGCCAATG
GGAAAGAGCTATTGAATCCTGATTTTCCTGGACTGCCAGAAAATTTTAGCGATGAAAACTATACTCCACCGGAGACTGCA
AACTGTATTGTGAGTTTGCTCTGTGAGCGTTACAATGCCATAGCTGTTGAGGCTAACACTATCAAGGAGTATTCCTTGAA
GCCTTACTTGAGAAAACTTTTCAATGAGAGAGTTCTAAGAGGTGATCCTTCCAACTATTCAGGAATTCTGGAGGCTTTAA
ACTTTGATGGAAATAACAAAGCCATAAATAAAGCTTATGAACAGCATGTACTTAGCGTTGGAGATCTGGATGAAAGAATA
TTTTTAGGACCTGATTCGAACTCCAATATAGGCTCATCTCCCTCAAAAATGATAAATATGACTGATTTACATGAGCAGTT
CCAATCCAAAAAGGAGCAACTAGGAACGATGCAGCATTGGGCTCCTCCAACACCTTTGACTGGACGGAAGTATCTCAAAG
CGAAAGACGTCACGAATACAGCTCCAAATGCGAACCCTACGCAAAGTGTCATTCGCCTACAAAGTCTTTTAGTAGGATGT
CAGGCTCTGCCATCAGAAAAACTTTTGGAGATGTTCAAAAATCGTTCTCCAGACATACAGACTTTTGTGGATTCAAAAAT
TCAGGATTTTGGAAAGATGTTCTGCGAGGCATACTCGCCTAAAGTGACTGAACAAGCTGAGAATAACTGTATAGATTACG
GGAAGAAGCGTTTGCAGTCTGCACAAACGCTTTTCTATAAAGTTTTAGAATTAGTTTTAAATGATGAAATGTCAAAAAAA
CCAAACTTTGATGTGACGATTCTGCTAAAGAATCACGATTTTCTTCAATGTTTATTCGCATGCTGTTGCGAAATCGTGCT
TTATTCGTACCATTACAAGGAAAGAACTTTCCCATGGATTCTCAAAGCTTTAAATATAGAAGCTTACTTATTTTACAAAG
TGATCGAGGTCATTGTCAAAGTAGCCGTTGACCAGTTAACTCGTGACATGGTCAAGCACTTAAATCGTATCGAAGAAATG
ATTCTCGAGTCTTTAGCCTGGAAATCTGGCAGTCCTCTGTGGAGAGCTCTTAAAGATTGCGATGAAGGTGTTCCCTCCTA
CGAAGATGTCGCTCTTCCCGGTACATTTGATTTAGTTGACCCAAATGCACCAGGTCAACCTGTTCTCAGAAGAATCCACA
TTGACAGAGGAGCAGCACATCATGATGTTGTCCAAAGTCCCATATCCTCTGCTTCCGAGAGGTTCCAGTCTCCGATACCT
TCAGGACTCGCCAAAAAGCGCCTCTTCTCAGATACCAAACCGGGCGGCGCCCAGAGTGTTCTGAAAGCCGGCGGACAGAG
TTTACTATCACGACTCACAGATCAATCTAACCCCACGAGAAATGGTGTCGGACCTGTGTCGAGCACCCCGATTGCCACCG
TAAACCGTGACCAGAGCAAGCCGCGTCGCACTGGTTCGCTGGCTCTGTTCTTCAGAAAATTCTATAATCTTACTATCACA
CGAATGCAAAATTTGTGCCAGTCGCTCGAAATCACAGATATTGATCTCAAGCGTAAAATTTGGACGATATTCGAGTATTC
AGTAAAAGAGCGAACACATCTCATGAAAGACAGACACCTCGACCAGATTCTCATGTCGGCGGTCTATGTAATCTGTAAGG
TCGGCAAGATTGGCAAGAATACTTTCACGGAAATTATGCGTTGCTACAGGTTCCAACCGCAAGCCGAGTCACACATCTAC
CGTTCGGTCCTTATATCTACAAACATCGACGACAACTCTGAGGCAGCTTTGGAGAACGGCAGCAACAGAAACAGCCAGAC
AAACAACACGTGTCCGCCCACGCCGTCAGACATGGCCAGCACCTCGCGTATCTACGGCTCTGAGGAACGCGGCGACCTTA
TCAAGTTCTACAATACGGTCTATGTACCAGAGGTAAAGGACTTTGCAAAGAAGCTTGGCCTCACCGAGGGTAGCGTCACG
AACCTCACACTGAGTCCACTCCCTCGGGGCAGGACGATAACTCACATCAGCTCGCCAGTCAGGCGTGTTACCGATAGTGT
CATGACGCGTGTACTGGATCCCAAGGAAATTGCCGCGTCACCAGCACCTCAATTACATTATTGCTTCAATCGGAGTCCGG
CTAGAGACTTGGAATCGATCAACAGAATGATGACGTCAATCGACGCGCGAAGATGCGTAGGAAAGCGATTACTTTCCGAT
GACACGGAGATCCCATCCTCGCTATCAGACAATGAGCCAGCGGAATCAGTAGACGATTCATTGACTGACGGACAGTACAT
AGTGCCGACCACGTACCACGTAGTGGATGAAGTTTAA
PEP:
>NV15596-PA
MGQSDDIEDATFMKHQDLCQKLNMDASAASEAWKSYENIRQHYTLEGDQLHWIGCALYAACRKATTPTVGKTGANIQGNC
VSFTRLLRLCNLPLIEFFTKSKAWADMCNMPQDFGARIDTLQRNFSVSSVIFQKYQPIFKDIFKNPADDLGKPLRSRRHK
AVPCTPSRLFEFCWSLFICIKSKISAISDDLVNSYHLLLVCCDLMYSNALLANGKELLNPDFPGLPENFSDENYTPPETA
NCIVSLLCERYNAIAVEANTIKEYSLKPYLRKLFNERVLRGDPSNYSGILEALNFDGNNKAINKAYEQHVLSVGDLDERI
FLGPDSNSNIGSSPSKMINMTDLHEQFQSKKEQLGTMQHWAPPTPLTGRKYLKAKDVTNTAPNANPTQSVIRLQSLLVGC
QALPSEKLLEMFKNRSPDIQTFVDSKIQDFGKMFCEAYSPKVTEQAENNCIDYGKKRLQSAQTLFYKVLELVLNDEMSKK
PNFDVTILLKNHDFLQCLFACCCEIVLYSYHYKERTFPWILKALNIEAYLFYKVIEVIVKVAVDQLTRDMVKHLNRIEEM
ILESLAWKSGSPLWRALKDCDEGVPSYEDVALPGTFDLVDPNAPGQPVLRRIHIDRGAAHHDVVQSPISSASERFQSPIP
SGLAKKRLFSDTKPGGAQSVLKAGGQSLLSRLTDQSNPTRNGVGPVSSTPIATVNRDQSKPRRTGSLALFFRKFYNLTIT
RMQNLCQSLEITDIDLKRKIWTIFEYSVKERTHLMKDRHLDQILMSAVYVICKVGKIGKNTFTEIMRCYRFQPQAESHIY
RSVLISTNIDDNSEAALENGSNRNSQTNNTCPPTPSDMASTSRIYGSEERGDLIKFYNTVYVPEVKDFAKKLGLTEGSVT
NLTLSPLPRGRTITHISSPVRRVTDSVMTRVLDPKEIAASPAPQLHYCFNRSPARDLESINRMMTSIDARRCVGKRLLSD
DTEIPSSLSDNEPAESVDDSLTDGQYIVPTTYHVVDEV
Swiss-ProtRetinoblastoma-like protein 1
KEGGko04350    TGF-beta signaling pathway
ko04110    Cell cycle
ko05203    Viral carcinogenesis
     K04681  RBL1; retinoblastoma-like protein 1     
OrthologiGroup-00010    Retinoblastoma-like protein     

You might be interested in these researchers

You might be interested in these references