Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Pediculus humanus
GenePHUM452350
PositionDS235787:81205..83444[GBrowse]
VectorBasehttp://www.vectorbase.org/search/site/PHUM452350
Gene Expressionhttps://www.vectorbase.org/expression-browser/gene/PHUM452350
sequence mRNA:
>PHUM452350-RA
ATGGTATCTGGAGAGAAAAGAAATTGTGAAGGAGGAAATTTGTTGGATAAGACTGTAGCCATATTACTTGATATTGAAGG
GACCACTACACCCATTAGTTTTGTTAAGGATGTACTTTTCCCTTATGTTCGTGAAAATTTAAAATCTTATGTCGATTCTC
ATTGGAACGATGAAGAATTTGCAGAAGATTTAAAAGCATTGAAACAACAGGCTAAAAAAGATGAAGAAGATAAAGTTGAA
AATTTATGTTTAATCGAAGATGGGGAAAAAGAAAAGGAAACACTTATTAAAAATGTACTTTGGCAAATGGATCTCGATAG
GAAAACGACAGCATTAAAACAATTACAGGGTCACATTTGGAGAGAAGGTTATGAAAAAGGAAAATTAAAGGGAATCGTTT
ACAATGACGTTTCACAAATGTTAAAAAAATGGTGTGAAAACGATAAGAAATTATACATATATTCATCTGGGAGCGTTGAA
GCTCAAAAACTATTGTTTAAAAATTCAGAATCTGGAGATCTTGAAACTTATTTAAATGGTCATTTCGATACTGAAATAGG
ACCCAAAACGGAAGCTTCCAGTTACGTAAGCATTGCCAAAGCCGTTGGACTTGACTGTAATCAAATCCTGTTTCTAACAG
ATTCCATAAAAGAAGCTGTTGCTGCTGACAAAGCGGGTATGCAAGTCAACGTCGTCGTGAGAGAGGGTAACGTTCCACTC
ACGGACGATGAGAAAAAAGCATTCACGGTCGTGTCAAATTTCAATGACATCGTTTTCGAGAGTAGCAATAAGAAAAAGAA
ATTGTGCGAAACGGGACAGGAAACTGAAAAAGTAGAAAACACATGA
PEP:
>PHUM452350-PA
MVSGEKRNCEGGNLLDKTVAILLDIEGTTTPISFVKDVLFPYVRENLKSYVDSHWNDEEFAEDLKALKQQAKKDEEDKVE
NLCLIEDGEKEKETLIKNVLWQMDLDRKTTALKQLQGHIWREGYEKGKLKGIVYNDVSQMLKKWCENDKKLYIYSSGSVE
AQKLLFKNSESGDLETYLNGHFDTEIGPKTEASSYVSIAKAVGLDCNQILFLTDSIKEAVAADKAGMQVNVVVREGNVPL
TDDEKKAFTVVSNFNDIVFESSNKKKKLCETGQETEKVENT
Swiss-ProtEnolase-phosphatase E1
KEGGko00270    Cysteine and methionine metabolism
     K09880  mtnC, ENOPH1; enolase-phosphatase E1 [EC:3.1.3.77]     
SUPERFAMILYSSF56784  HAD-like superfamily     
Gene3DG3DSA:3.40.50.1000     
PfamPF13419  HAD_2; Haloacid dehalogenase-like hydrolase     
CoilsCoil
TIGRFAMTIGR01549     
HamapMF_03117     
PANTHERPTHR20371
OrthologiGroup-00009    Enolase-phosphatase E1      

You might be interested in these researchers

You might be interested in these references