Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Aedes aegypti
GeneAAEL000091
Positionsupercont1.1:2722209..2724385[GBrowse]
VectorBasehttp://www.vectorbase.org/search/site/AAEL000091
Gene Expressionhttps://www.vectorbase.org/expression-browser/gene/AAEL000091
sequence mRNA:
>AAEL000091-RA
TGTCTGTCATCAAAAGAATCAAACAAAACCGCAGACGCCGCCTTGGAAATCGGACGCTGAATCAGAAAAGTTGACCGCAA
AAGTTTAAATTATTTGGTGAAAACTGCAGATAAACAGCTTAAAAATGGTTGAAGCAAACGGAATTGAGCTGACCGAACAG
GAAGCTGAGTTGTACGATCGCCAAATTCGTTTGTGGGGATTGGATTCCCAGAAAAGATTGCGAGCGGCTCGTATTTTGAT
TGCCGGTGTCAATGGTTTGGGAGCGGAAATAGCCAAGAATGTGATTTTATCCGGTGTGAAAGCCGTGACGTTGTTGGACG
ATCAGGTTGTGAAGGAAGCTGACTTCTGTTCGCAATTTTTGGCTCCCCAGGATTCTTTGAGAACGAACCGTGCGGAAGCT
TCTTTGTCTCGGGCTCAGCAGCTGAATCCAATGGTGGAGCTGAAGGCGGATACCGAAGAACTGCCCAAGAAGACGGACGA
TTTCTTCAAGGGATTCGATGTGGTGTGCGTTATCGGTGCTAATACGGAACAGTTACTTCGCATTGACGGTGTATGCCGAG
AAGCCGGTATCAAATTCTTTGCAGCTGATCTGTGGGGAATGTTCGGATTCAGTTTTGCCGATCTACAGGAGCACAACTTT
GCTGAGGATGTCGTAAAGCATAAGATAGTGTCCAAACCACACGAAAAGACCAAGACTGAGTTGGTTACTTCCACGGTAAA
GCGGACGCTATCTTACCCGGCCTATCAAGTCCTGTTGGACTTTGACTACAAGGCCCAATCGTATGCCAGGAAGCTGAAAC
GCTCAGGACCGGCACTGCCTTTGCTGCGCGTATTGCAAAAGTTCCGCGATGACGAGAAACGTGACCCACTGTACTCCGAG
CGGGAAGCAGATCTACAGAAGTTGCTGAAGATTCGCGACGAAGTGGCTGCCGATTTGATCCCGGACAATGCCTTCTTGCA
CGTTTTCGCCCAAATCTCGCCAGCTGCGGCCATCGTCGGTGGAGCAGTGGCGCATGAGATCATCAAAACCGTCTCGCAAA
AGGAAGCCCCACATCACAATGTGTTTTTGTTCGATCCGGAAAGCTGCTGTGGTTTCATCGAGTCGATTGGCGTGGATGCC
TAAAAGGCGCTTCACTGTAATCCGCAACGGAAATAACTTTTAAGCCGTATATACTTTAATATCTATCAGTAATCTATTCA
ATAAACATAATGATCTTATTTTCACGGAACATTCTTAACCAAACCGAAACTTTTGCTGTTTTCATTAGTATTATGATTTT
CAACTCAACTTTATTGATATCTCTGTTTGTTTAGAGACTTGACCACTATTTTAATGCAAGTCTAAAATGTCTAAGTCTCT
CTTTTAACCAAAATAATCCCTAAACTAATTTCTCACAGTCGTTAGCTACTAAGTGTAACATTCTTGAGGCTCACGAAAAA
CTTCCAGAAACTCTTTGATTACACATTTTATGCGCGACTATTCTTCAGATTATTCGGACATTTCTGCTTATTGATTTTTC
AAGGACTTGGGGTGGTTGTCAAGAAGAGAAGAACAATTTAGTCAGTAGTACAAGCTATACCGTGTAACACCGCGTTGAAA
TTGTCATCGTAATAAATTATAATTTCCGAGAAAAAAA
PEP:
>AAEL000091-PA
MVEANGIELTEQEAELYDRQIRLWGLDSQKRLRAARILIAGVNGLGAEIAKNVILSGVKAVTLLDDQVVKEADFCSQFLA
PQDSLRTNRAEASLSRAQQLNPMVELKADTEELPKKTDDFFKGFDVVCVIGANTEQLLRIDGVCREAGIKFFAADLWGMF
GFSFADLQEHNFAEDVVKHKIVSKPHEKTKTELVTSTVKRTLSYPAYQVLLDFDYKAQSYARKLKRSGPALPLLRVLQKF
RDDEKRDPLYSEREADLQKLLKIRDEVAADLIPDNAFLHVFAQISPAAAIVGGAVAHEIIKTVSQKEAPHHNVFLFDPES
CCGFIESIGVDA
Swiss-ProtSUMO-activating enzyme subunit 1
KEGGko04120    Ubiquitin mediated proteolysis
     K10684  UBLE1A, SAE1; ubiquitin-like 1-activating enzyme E1 A [EC:6.3.2.19]     
SUPERFAMILYSSF69572  Activating enzymes of the ubiquitin-like proteins superfamily     
Gene3DG3DSA:3.40.50.720     
PfamPF00899  ThiF; ThiF family     
PRINTSPR01849     
PANTHERPTHR10953
OrthologiGroup-00008    SUMO-activating enzyme subunit     

You might be interested in these researchers

You might be interested in these references